PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678361979
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family SRS
Protein Properties Length: 286aa    MW: 30906.6 Da    PI: 7.9887
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678361979genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702166.51.5e-51241534153
     DUF702   4 gtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssaeskkelets 103
                 +++CqdCGnqakkdC+h RCRtCC+srgf+C th+kstW+p+a+rr r+   +  +++    +++ ++k+ r                 ++++  +  +
  678361979  24 SSSRCQDCGNQAKKDCEHLRCRTCCRSRGFQCLTHIKSTWIPVARRRPRHLLIHHHHQQP---SDHPNPKKYR-----------------ENQPPAFLGR 103
                5679********************************************955544432222...1122222222.................2344566778 PP

     DUF702 104 slPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGle 153
                ++Peevs +avfrcvrvss+d   +++aYqt+v+i+Ghvf GiLydqG+ 
  678361979 104 EFPEEVSFPAVFRCVRVSSIDSMVDQYAYQTSVNISGHVFTGILYDQGPP 153
                8***********************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051423.1E-5225152IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016231.9E-252869IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016245.0E-24105152IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MMSGGGGGGG GEEAEAMNSC SSVSSSRCQD CGNQAKKDCE HLRCRTCCRS RGFQCLTHIK  60
STWIPVARRR PRHLLIHHHH QQPSDHPNPK KYRENQPPAF LGREFPEEVS FPAVFRCVRV  120
SSIDSMVDQY AYQTSVNISG HVFTGILYDQ GPPETAGPVK FLTGGSSSSA AAAGLLQQPH  180
FLAATAGSAT GATSPHYPSP NPFSGEFEAK NAGKLANEDM KGTLMVLNST RSANSRRTEP  240
SAPAYDLEAT HRVGEEISEV FRWLSAEMDI LGVDGFPLKV KSQGRG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011088766.13e-66PREDICTED: protein SHI RELATED SEQUENCE 1-like
TrEMBLS8BY382e-79S8BY38_9LAMI; Uncharacterized protein (Fragment)
STRINGSolyc01g110140.2.15e-60(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41562445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G51060.14e-40Lateral root primordium (LRP) protein-related